PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_19368A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 217aa    MW: 22812.6 Da    PI: 4.5147
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_19368AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-152267148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg++T  E+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  Oropetium_20150105_19368A 22 RGNFTVAEEETIIKLHGLLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 67
                               89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.135116IPR017877Myb-like domain
SuperFamilySSF466892.78E-20373IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-10329IPR009057Homeodomain-like
PROSITE profilePS5129424.1821771IPR017930Myb domain
SMARTSM007172.0E-132169IPR001005SANT/Myb domain
PfamPF002498.4E-142267IPR001005SANT/Myb domain
CDDcd001677.27E-112467No hitNo description
Gene3DG3DSA:1.10.10.602.4E-213068IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
LLRCGKSCRL RWINYLRPDL KRGNFTVAEE ETIIKLHGLL GNKWSKIAAC LPGRTDNEIK  60
NVWNTHLKKK VAQKEQQKAG ATNNEDGVAS GDAAATQITS SSASSSTITA NSSGVGGDAG  120
DQCGTSKEPD AIDIIPPLEL EPDIDISDML VDAPAGPLPA AAEPMPPSSP CSSSSLTTCG  180
VEHLIELPVI DIELDMWSII DGNGDSGARH GDATTVP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-2037140108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794372e-74HF679437.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB31 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953532.15e-82PREDICTED: myb-related protein Zm1-like
SwissprotP200242e-79MYB1_MAIZE; Myb-related protein Zm1
TrEMBLK3YTV85e-82K3YTV8_SETIT; Uncharacterized protein
STRINGSi017704m1e-81(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-37myb domain protein 63